Lineage for d2gtqa4 (2gtq A:540-866)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006896Family a.118.1.27: Aminopeptidase N (APN) C-terminal-like [254179] (1 protein)
    PubMed 17876832; C-terminal part of Pfam PF11940
  6. 2006897Protein Aminopeptidase N (APN) C-terminal domain [254402] (1 species)
  7. 2006898Species Neisseria meningitidis [TaxId:122586] [254838] (9 PDB entries)
  8. 2006902Domain d2gtqa4: 2gtq A:540-866 [241981]
    Other proteins in same PDB: d2gtqa1, d2gtqa2, d2gtqa3
    complexed with so4, zn

Details for d2gtqa4

PDB Entry: 2gtq (more details), 2.05 Å

PDB Description: Crystal structure of aminopeptidase N from human pathogen Neisseria meningitidis
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d2gtqa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtqa4 a.118.1.27 (A:540-866) Aminopeptidase N (APN) C-terminal domain {Neisseria meningitidis [TaxId: 122586]}
pysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvis
ddlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaa
kqenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavn
gnesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnk
arsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrkn
lvkqalqriraqeglskdvgeivgkil

SCOPe Domain Coordinates for d2gtqa4:

Click to download the PDB-style file with coordinates for d2gtqa4.
(The format of our PDB-style files is described here.)

Timeline for d2gtqa4: