Lineage for d2gtqa3 (2gtq A:439-539)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766974Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)
  6. 2766975Protein Aminopeptidase N (APN) domain 3 [254401] (1 species)
    PubMed 17876832; N-terminal part of Pfam PF11940
  7. 2766976Species Neisseria meningitidis [TaxId:122586] [254837] (9 PDB entries)
  8. 2766979Domain d2gtqa3: 2gtq A:439-539 [241980]
    Other proteins in same PDB: d2gtqa1, d2gtqa2, d2gtqa4
    complexed with so4, zn

Details for d2gtqa3

PDB Entry: 2gtq (more details), 2.05 Å

PDB Description: Crystal structure of aminopeptidase N from human pathogen Neisseria meningitidis
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d2gtqa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtqa3 b.1.30.1 (A:439-539) Aminopeptidase N (APN) domain 3 {Neisseria meningitidis [TaxId: 122586]}
agtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgllnrngeavafdyqgk
rateavlllteaeqtfllegvteavvpsllrgfsapvhlny

SCOPe Domain Coordinates for d2gtqa3:

Click to download the PDB-style file with coordinates for d2gtqa3.
(The format of our PDB-style files is described here.)

Timeline for d2gtqa3: