![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
![]() | Protein Galectin-7 [100926] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries) |
![]() | Domain d2gala_: 2gal A: [24198] complexed with gal |
PDB Entry: 2gal (more details), 2 Å
SCOPe Domain Sequences for d2gala_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gala_ b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]} vphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfn skeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlve vggdvqldsvrif
Timeline for d2gala_: