SCOPe 2.08: Domain d2gala_: 2gal A:

Lineage for d2gala_ (2gal A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-7 [100926] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49935] (6 PDB entries)

8. Domain d2gala_: 2gal A: [24198]
   complexed with gal

Details for d2gala_

PDB Entry: 2gal, 2 Å

PDB Description: crystal structure of human galectin-7 in complex with galactose

PDB Compounds: (A:) galectin-7

SCOPe Domain Sequences for d2gala_:

Sequence; same for both SEQRES and ATOM records:

>d2gala_ b.29.1.3 (A:) Galectin-7 {Human (Homo sapiens) [TaxId: 9606]}
vphksslpegirpgtvlrirglvppnasrfhvnllcgeeqgsdaalhfnprldtsevvfn
skeqgswgreergpgvpfqrgqpfevliiasddgfkavvgdaqyhhfrhrlplarvrlve
vggdvqldsvrif

Timeline for d2gala_:

• d2gala_ first appeared (with stable ids) in SCOP 1.55
  
• d2gala_ appears in SCOPe 2.07