SCOPe 2.07: Domain d2gtqa2: 2gtq A:189-438

Lineage for d2gtqa2 (2gtq A:189-438)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
   adopts thermolysin-like fold

6. Protein Aminopeptidase N (APN) catalytic domain [254400] (1 species)

7. Species Neisseria meningitidis [TaxId:122586] [254836] (9 PDB entries)

8. Domain d2gtqa2: 2gtq A:189-438 [241979]
   Other proteins in same PDB: d2gtqa1, d2gtqa3, d2gtqa4
   complexed with so4, zn

Details for d2gtqa2

PDB Entry: 2gtq, 2.05 Å

PDB Description: Crystal structure of aminopeptidase N from human pathogen Neisseria meningitidis

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d2gtqa2:

Sequence; same for both SEQRES and ATOM records:

>d2gtqa2 d.92.1.13 (A:189-438) Aminopeptidase N (APN) catalytic domain {Neisseria meningitidis [TaxId: 122586]}
dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv
vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd
wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem
nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin
ldqfalwysq

Timeline for d2gtqa2:

• d2gtqa2 first appeared in SCOPe 2.04
  
• d2gtqa2 appears in SCOPe 2.06
  
• d2gtqa2 appears in the current release, SCOPe 2.08