Lineage for d2grac2 (2gra C:165-275)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721650Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2721743Domain d2grac2: 2gra C:165-275 [241968]
    Other proteins in same PDB: d2graa1, d2graa3, d2grab1, d2grab3, d2grac1, d2grac3, d2grad1, d2grad3, d2grae1, d2grae3
    automated match to d2izzb2
    complexed with glu, nap

Details for d2grac2

PDB Entry: 2gra (more details), 3.1 Å

PDB Description: crystal structure of Human Pyrroline-5-carboxylate Reductase complexed with nadp
PDB Compounds: (C:) Pyrroline-5-carboxylate reductase 1

SCOPe Domain Sequences for d2grac2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grac2 a.100.1.0 (C:165-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqe

SCOPe Domain Coordinates for d2grac2:

Click to download the PDB-style file with coordinates for d2grac2.
(The format of our PDB-style files is described here.)

Timeline for d2grac2: