| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
| Protein automated matches [226851] (46 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries) |
| Domain d2grab2: 2gra B:165-275 [241966] Other proteins in same PDB: d2graa1, d2graa3, d2grab1, d2grab3, d2grac1, d2grac3, d2grad1, d2grad3, d2grae1, d2grae3 automated match to d2izzb2 complexed with glu, nap |
PDB Entry: 2gra (more details), 3.1 Å
SCOPe Domain Sequences for d2grab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grab2 a.100.1.0 (B:165-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqe
Timeline for d2grab2: