Lineage for d1slaa_ (1sla A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108496Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 108497Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) (S)
  5. 108825Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins)
  6. 108838Protein S-lectin, different isoforms [49933] (4 species)
  7. 108842Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)
  8. 108853Domain d1slaa_: 1sla A: [24196]

Details for d1slaa_

PDB Entry: 1sla (more details), 2.45 Å

PDB Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides

SCOP Domain Sequences for d1slaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slaa_ b.29.1.3 (A:) S-lectin, different isoforms {Cow (Bos taurus)}
acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
saggdfkikcvafe

SCOP Domain Coordinates for d1slaa_:

Click to download the PDB-style file with coordinates for d1slaa_.
(The format of our PDB-style files is described here.)

Timeline for d1slaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1slab_