Lineage for d1slaa_ (1sla A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779208Protein Galectin-1 [100925] (5 species)
  7. 2779212Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)
  8. 2779223Domain d1slaa_: 1sla A: [24196]

Details for d1slaa_

PDB Entry: 1sla (more details), 2.45 Å

PDB Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides
PDB Compounds: (A:) bovine galectin-1

SCOPe Domain Sequences for d1slaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slaa_ b.29.1.3 (A:) Galectin-1 {Cow (Bos taurus) [TaxId: 9913]}
acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
saggdfkikcvafe

SCOPe Domain Coordinates for d1slaa_:

Click to download the PDB-style file with coordinates for d1slaa_.
(The format of our PDB-style files is described here.)

Timeline for d1slaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1slab_