Lineage for d2gr9b1 (2gr9 B:1-164)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2455436Species Human (Homo sapiens) [TaxId:9606] [186944] (62 PDB entries)
  8. 2455678Domain d2gr9b1: 2gr9 B:1-164 [241955]
    Other proteins in same PDB: d2gr9a2, d2gr9a3, d2gr9b2, d2gr9b3, d2gr9c2, d2gr9c3, d2gr9d2, d2gr9d3, d2gr9e2, d2gr9e3
    automated match to d2izzb1
    complexed with glu, nai

Details for d2gr9b1

PDB Entry: 2gr9 (more details), 3.1 Å

PDB Description: crystal structure of p5cr complexed with nadh
PDB Compounds: (B:) Pyrroline-5-carboxylate reductase 1

SCOPe Domain Sequences for d2gr9b1:

Sequence, based on SEQRES records: (download)

>d2gr9b1 c.2.1.0 (B:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv
qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc
mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee

Sequence, based on observed residues (ATOM records): (download)

>d2gr9b1 c.2.1.0 (B:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvltphnketvq
hsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvircm
tntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee

SCOPe Domain Coordinates for d2gr9b1:

Click to download the PDB-style file with coordinates for d2gr9b1.
(The format of our PDB-style files is described here.)

Timeline for d2gr9b1: