Lineage for d2gr9a2 (2gr9 A:165-275)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742411Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1742412Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1742617Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1742618Protein automated matches [226851] (30 species)
    not a true protein
  7. 1742692Species Human (Homo sapiens) [TaxId:9606] [225061] (13 PDB entries)
  8. 1742733Domain d2gr9a2: 2gr9 A:165-275 [241954]
    Other proteins in same PDB: d2gr9a1, d2gr9b1, d2gr9c1, d2gr9d1, d2gr9e1
    automated match to d2izzb2
    complexed with glu, nai

Details for d2gr9a2

PDB Entry: 2gr9 (more details), 3.1 Å

PDB Description: crystal structure of p5cr complexed with nadh
PDB Compounds: (A:) Pyrroline-5-carboxylate reductase 1

SCOPe Domain Sequences for d2gr9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gr9a2 a.100.1.0 (A:165-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqe

SCOPe Domain Coordinates for d2gr9a2:

Click to download the PDB-style file with coordinates for d2gr9a2.
(The format of our PDB-style files is described here.)

Timeline for d2gr9a2: