| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (309 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186944] (62 PDB entries) |
| Domain d2gr9a1: 2gr9 A:1-164 [241953] Other proteins in same PDB: d2gr9a2, d2gr9a3, d2gr9b2, d2gr9b3, d2gr9c2, d2gr9c3, d2gr9d2, d2gr9d3, d2gr9e2, d2gr9e3 automated match to d2izzb1 complexed with glu, nai |
PDB Entry: 2gr9 (more details), 3.1 Å
SCOPe Domain Sequences for d2gr9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gr9a1 c.2.1.0 (A:1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnketv
qhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvirc
mtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee
Timeline for d2gr9a1: