SCOPe 2.05: Domain d2gqka_: 2gqk A:

Lineage for d2gqka_ (2gqk A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (102 PDB entries)

8. Domain d2gqka_: 2gqk A: [241950]
   automated match to d2b7ja1
   complexed with ni

Details for d2gqka_

PDB Entry: 2gqk

PDB Description: solution structure of human ni(ii)-sco1

PDB Compounds: (A:) SCO1 protein homolog, mitochondrial

SCOPe Domain Sequences for d2gqka_:

Sequence; same for both SEQRES and ATOM records:

>d2gqka_ c.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sftgkpllggpfsltthtgerktdkdylgqwlliyfgfthcpdvcpeelekmiqvvdeid
sittlpdltplfisidperdtkeaianyvkefspklvgltgtreevdqvarayrvyyspg
pkdededyivdhtiimyligpdgefldyfgqnkrkgeiaasiathmrpyrkks

Timeline for d2gqka_:

• d2gqka_ first appeared in SCOPe 2.04
  
• d2gqka_ is called d2gqka1 in SCOPe 2.06
  
• d2gqka_ appears in the current release, SCOPe 2.08, called d2gqka1