Lineage for d2gq0b_ (2gq0 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2930059Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2930060Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2930912Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2930913Protein automated matches [190826] (23 species)
    not a true protein
  7. 2930992Species Escherichia coli [TaxId:562] [255192] (4 PDB entries)
  8. 2930995Domain d2gq0b_: 2gq0 B: [241948]
    automated match to d3pryc_

Details for d2gq0b_

PDB Entry: 2gq0 (more details), 1.9 Å

PDB Description: crystal structure of the middle domain of htpg, the e. coli hsp90
PDB Compounds: (B:) Chaperone protein htpG

SCOPe Domain Sequences for d2gq0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gq0b_ d.14.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
qalwtrnkseitdeeykefykhiahdfndpltwshnrvegkqeytsllyipsqapwdmwn
rdhkhglklyvqrvfimddaeqfmpnylrfvrglidssdlplnvsreilqdstvtrnlrn
altkrvlqmleklakddaekyqtfwqqfglvlkegpaedfanqeaiakllrfasthtdss
aqtvsledyvsrmkegqekiyyitadsyaaakssphlellrkkgievlllsdridewmmn
yltefdgkpfqsvskvdeslekla

SCOPe Domain Coordinates for d2gq0b_:

Click to download the PDB-style file with coordinates for d2gq0b_.
(The format of our PDB-style files is described here.)

Timeline for d2gq0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2gq0a_