SCOPe 2.06: Domain d2gp3b_: 2gp3 B:

Lineage for d2gp3b_ (2gp3 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.14: Histone demethylase core [254153] (4 proteins)
   Jumonji domain; Pfam PF02375 (JmjN) and Pfam PF02373 (JmjC); relationship to FIH1 (b.82.2.6) described in PubMed 16983801

6. Protein JMJD2A core [254342] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254775] (41 PDB entries)

8. Domain d2gp3b_: 2gp3 B: [241944]
   automated match to d2gp5a_
   complexed with fe2, zn

Details for d2gp3b_

PDB Entry: 2gp3, 2.35 Å

PDB Description: Crystal structure of the catalytic core domain of jmjd2a

PDB Compounds: (B:) Jumonji domain-containing protein 2A

SCOPe Domain Sequences for d2gp3b_:

Sequence; same for both SEQRES and ATOM records:

>d2gp3b_ b.82.2.14 (B:) JMJD2A core {Human (Homo sapiens) [TaxId: 9606]}
psarimtfyptmeefrnfsryiayiesqgahraglakvvppkewkprasyddiddlvipa
piqqlvtgqsglftqyniqkkamtvrefrkiansdkyctprysefeelerkywknltfnp
piygadvngtlyekhvdewnigrlrtildlvekesgitiegvntpylyfgmwktsfawht
edmdlysinylhfgepkswysvppehgkrlerlakgffpgsaqsceaflrhkmtlisplm
lkkygipfdkvtqeagefmitfpygyhagfnhgfncaestnfatrrwieygkqavlcscr
kdmvkismdvfvrkfqperyklwkagkdntvidhtlptp

Timeline for d2gp3b_:

• d2gp3b_ first appeared in SCOPe 2.04
  
• d2gp3b_ appears in SCOPe 2.05
  
• d2gp3b_ appears in SCOPe 2.07
  
• d2gp3b_ appears in the current release, SCOPe 2.08