SCOPe 2.08: Domain d2go9a2: 2go9 A:80-161

Lineage for d2go9a2 (2go9 A:80-161)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein U4/U6 snRNA-associated-splicing factor PRP24 [143338] (1 species)
   contains three RBDs

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143339] (2 PDB entries)
   Uniprot P49960 116-196! Uniprot P49960 206-291! Uniprot P49960 41-115

8. Domain d2go9a2: 2go9 A:80-161 [241942]
   automated match to d2ghpa1

Details for d2go9a2

PDB Entry: 2go9

PDB Description: rrm domains 1 and 2 of prp24 from s. cerevisiae

PDB Compounds: (A:) U4/U6 snRNA-associated splicing factor PRP24

SCOPe Domain Sequences for d2go9a2:

Sequence; same for both SEQRES and ATOM records:

>d2go9a2 d.58.7.1 (A:80-161) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ectlwmtnfppsytqrnirdllqdinvvalsirlpslrfntsrrfayidvtskedarycv
eklnglkiegytlvtkvsnple

Timeline for d2go9a2:

• d2go9a2 first appeared in SCOPe 2.04
  
• d2go9a2 appears in SCOPe 2.07