Lineage for d2go9a1 (2go9 A:1-79)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2558726Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2559175Protein U4/U6 snRNA-associated-splicing factor PRP24 [143338] (1 species)
    contains three RBDs
  7. 2559176Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143339] (2 PDB entries)
    Uniprot P49960 116-196! Uniprot P49960 206-291! Uniprot P49960 41-115
  8. 2559201Domain d2go9a1: 2go9 A:1-79 [241941]
    automated match to d2ghpa2

Details for d2go9a1

PDB Entry: 2go9 (more details)

PDB Description: rrm domains 1 and 2 of prp24 from s. cerevisiae
PDB Compounds: (A:) U4/U6 snRNA-associated splicing factor PRP24

SCOPe Domain Sequences for d2go9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2go9a1 d.58.7.1 (A:1-79) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mrelttvlvknlpksynqnkvykyfkhcgpiihvdvadslkknfrfariefarydgalaa
itkthkvvgqneiivshlt

SCOPe Domain Coordinates for d2go9a1:

Click to download the PDB-style file with coordinates for d2go9a1.
(The format of our PDB-style files is described here.)

Timeline for d2go9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2go9a2