Lineage for d1slbc_ (1slb C:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663732Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)
  6. 663749Protein Galectin-1 [100925] (4 species)
  7. 663753Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)
  8. 663762Domain d1slbc_: 1slb C: [24194]

Details for d1slbc_

PDB Entry: 1slb (more details), 2.3 Å

PDB Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides
PDB Compounds: (C:) bovine galectin-1

SCOP Domain Sequences for d1slbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slbc_ b.29.1.3 (C:) Galectin-1 {Cow (Bos taurus) [TaxId: 9913]}
acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
saggdfkikcvafe

SCOP Domain Coordinates for d1slbc_:

Click to download the PDB-style file with coordinates for d1slbc_.
(The format of our PDB-style files is described here.)

Timeline for d1slbc_: