Lineage for d1slbc_ (1slb C:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 164840Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins)
  6. 164854Protein S-lectin, different isoforms [49933] (4 species)
  7. 164858Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)
  8. 164867Domain d1slbc_: 1slb C: [24194]

Details for d1slbc_

PDB Entry: 1slb (more details), 2.3 Å

PDB Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides

SCOP Domain Sequences for d1slbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slbc_ b.29.1.3 (C:) S-lectin, different isoforms {Cow (Bos taurus)}
acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
saggdfkikcvafe

SCOP Domain Coordinates for d1slbc_:

Click to download the PDB-style file with coordinates for d1slbc_.
(The format of our PDB-style files is described here.)

Timeline for d1slbc_: