Lineage for d2gjya1 (2gjy A:5-144)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803365Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2803435Protein automated matches [190580] (4 species)
    not a true protein
  7. 2803436Species Chicken (Gallus gallus) [TaxId:9031] [255189] (1 PDB entry)
  8. 2803437Domain d2gjya1: 2gjy A:5-144 [241935]
    Other proteins in same PDB: d2gjya2
    automated match to d3hqca_

Details for d2gjya1

PDB Entry: 2gjy (more details)

PDB Description: nmr solution structure of tensin1 ptb domain
PDB Compounds: (A:) Tensin

SCOPe Domain Sequences for d2gjya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gjya1 b.55.1.2 (A:5-144) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gaacnvlfinsvemesltgpqaiskavaetlvadptptativhfkvsaqgitltdnqrkl
ffrrhyplntvtfcdldpqerkwtktdgsgpaklfgfvarkqgsttdnvchlfaeldpdq
paaaivnfvsrvmlgsgqkr

SCOPe Domain Coordinates for d2gjya1:

Click to download the PDB-style file with coordinates for d2gjya1.
(The format of our PDB-style files is described here.)

Timeline for d2gjya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gjya2