SCOPe 2.08: Domain d2gjya1: 2gjy A:5-144

Lineage for d2gjya1 (2gjy A:5-144)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein automated matches [190580] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [255189] (1 PDB entry)

8. Domain d2gjya1: 2gjy A:5-144 [241935]
   Other proteins in same PDB: d2gjya2
   automated match to d3hqca_

Details for d2gjya1

PDB Entry: 2gjy

PDB Description: nmr solution structure of tensin1 ptb domain

PDB Compounds: (A:) Tensin

SCOPe Domain Sequences for d2gjya1:

Sequence; same for both SEQRES and ATOM records:

>d2gjya1 b.55.1.2 (A:5-144) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gaacnvlfinsvemesltgpqaiskavaetlvadptptativhfkvsaqgitltdnqrkl
ffrrhyplntvtfcdldpqerkwtktdgsgpaklfgfvarkqgsttdnvchlfaeldpdq
paaaivnfvsrvmlgsgqkr

Timeline for d2gjya1:

• d2gjya1 first appeared in SCOPe 2.04, called d2gjya_
  
• d2gjya1 appears in SCOPe 2.07