SCOPe 2.04: Domain d2gi4a_: 2gi4 A:

Lineage for d2gi4a_ (2gi4 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (13 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:197] [255186] (1 PDB entry)

8. Domain d2gi4a_: 2gi4 A: [241934]
   automated match to d4etma1

Details for d2gi4a_

PDB Entry: 2gi4

PDB Description: solution structure of the low molecular weight protein tyrosine phosphatase from campylobacter jejuni.

PDB Compounds: (A:) possible phosphotyrosine protein phosphatase

SCOPe Domain Sequences for d2gi4a_:

Sequence; same for both SEQRES and ATOM records:

>d2gi4a_ c.44.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
mkkilficlgnicrspmaefimkdlvkkanlekeffinsagtsgehdgegmhygtknkla
qlniehknftskkltqklcdesdflitmdnsnfknvlknftntqnkvlkitdfspslnyd
evpdpwysgnfdetykilslacknllvflskhhhhh

Timeline for d2gi4a_:

• d2gi4a_ is new in SCOPe 2.04-stable
  
• d2gi4a_ appears in SCOPe 2.05
  
• d2gi4a_ appears in the current release, SCOPe 2.08, called d2gi4a1