Lineage for d2ggzb_ (2ggz B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711650Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries)
  8. 2711702Domain d2ggzb_: 2ggz B: [241933]
    automated match to d2r2ia_
    complexed with ca

Details for d2ggzb_

PDB Entry: 2ggz (more details), 3 Å

PDB Description: Crystal Structure of Human Guanylate Cyclase Activating Protein-3
PDB Compounds: (B:) Guanylyl cyclase-activating protein 3

SCOPe Domain Sequences for d2ggzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggzb_ a.39.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wyrtfmmeypsglqtlhefktllglqglnqkankhidqvyntfdtnkdgfvdflefiaav
nlimqekmeqklkwyfklydadgngsidknelldmfmavqalngqqtlspeefinlvfhk
idinndgeltleefingmakdqdlleivyksfdfsnvlrvicngk

SCOPe Domain Coordinates for d2ggzb_:

Click to download the PDB-style file with coordinates for d2ggzb_.
(The format of our PDB-style files is described here.)

Timeline for d2ggzb_: