Lineage for d1slbb_ (1slb B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins) 
Protein S-lectin, different isoforms [49933] (4 species) Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries) 
Domain d1slbb_: 1slb B: [24193]
Details for d1slbb_
PDB Entry: 1slb (more details), 2.3 Å
PDB Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides
SCOP Domain Sequences for d1slbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1slbb_ b.29.1.3 (B:) S-lectin, different isoforms {Cow (Bos taurus)}
acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
saggdfkikcvafe
SCOP Domain Coordinates for d1slbb_:
Click to download the PDB-style file with coordinates for d1slbb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1slbb_:
- d1slbb_ appears in SCOP 1.57
- d1slbb_ appears in the current release, SCOPe 2.08
View in 3D
