![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries) |
![]() | Domain d2gerd2: 2ger D:165-275 [241928] Other proteins in same PDB: d2gera1, d2gera3, d2gerb1, d2gerb3, d2gerc1, d2gerc3, d2gerd1, d2gerd3, d2gere1, d2gere3 automated match to d2izzb2 |
PDB Entry: 2ger (more details), 3.1 Å
SCOPe Domain Sequences for d2gerd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gerd2 a.100.1.0 (D:165-275) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqe
Timeline for d2gerd2: