Lineage for d2gerd2 (2ger D:165-275)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721533Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 2721534Protein automated matches [226851] (46 species)
    not a true protein
  7. 2721650Species Human (Homo sapiens) [TaxId:9606] [225061] (28 PDB entries)
  8. 2721749Domain d2gerd2: 2ger D:165-275 [241928]
    Other proteins in same PDB: d2gera1, d2gera3, d2gerb1, d2gerb3, d2gerc1, d2gerc3, d2gerd1, d2gerd3, d2gere1, d2gere3
    automated match to d2izzb2

Details for d2gerd2

PDB Entry: 2ger (more details), 3.1 Å

PDB Description: Crystal Structure and Oxidative Mechanism of Human Pyrroline-5-carboxylate Reductase
PDB Compounds: (D:) Pyrroline-5-carboxylate reductase 1

SCOPe Domain Sequences for d2gerd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gerd2 a.100.1.0 (D:165-275) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlidavtglsgsgpayaftaldaladggvkmglprrlavrlgaqallgaakmllhseqhp
gqlkdnvsspggatihalhvlesggfrsllinaveascirtrelqsmadqe

SCOPe Domain Coordinates for d2gerd2:

Click to download the PDB-style file with coordinates for d2gerd2.
(The format of our PDB-style files is described here.)

Timeline for d2gerd2: