SCOPe 2.04: Domain d2gerd1: 2ger D:-1-164

Lineage for d2gerd1 (2ger D:-1-164)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (37 PDB entries)

8. Domain d2gerd1: 2ger D:-1-164 [241927]
   Other proteins in same PDB: d2gera2, d2gerb2, d2gerc2, d2gerd2, d2gere2
   automated match to d2izzb1

Details for d2gerd1

PDB Entry: 2ger, 3.1 Å

PDB Description: Crystal Structure and Oxidative Mechanism of Human Pyrroline-5-carboxylate Reductase

PDB Compounds: (D:) Pyrroline-5-carboxylate reductase 1

SCOPe Domain Sequences for d2gerd1:

Sequence; same for both SEQRES and ATOM records:

>d2gerd1 c.2.1.0 (D:-1-164) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ramsvgfigagqlafalakgftaagvlaahkimasspdmdlatvsalrkmgvkltphnke
tvqhsdvlflavkphiipfildeigadiedrhivvscaagvtissiekklsafrpaprvi
rcmtntpvvvregatvyatgthaqvedgrlmeqllssvgfctevee

Timeline for d2gerd1:

• d2gerd1 is new in SCOPe 2.04-stable
  
• d2gerd1 appears in SCOPe 2.05
  
• d2gerd1 appears in the current release, SCOPe 2.08