| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
| Family d.93.1.0: automated matches [191409] (1 protein) not a true family |
| Protein automated matches [190561] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187549] (78 PDB entries) |
| Domain d2ge9a_: 2ge9 A: [241920] automated match to d3uyoa_ |
PDB Entry: 2ge9 (more details)
SCOPe Domain Sequences for d2ge9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ge9a_ d.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teaedsiemyewyskhmtrsqaeqllkqegkeggfivrdsskagkytvsvfakstgdpqg
virhyvvcstpqsqyylaekhlfstipelinyhqhnsaglisrlkypvsqqnknapst
Timeline for d2ge9a_: