SCOPe 2.05: Domain d1slba_: 1slb A:

Lineage for d1slba_ (1slb A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)

8. Domain d1slba_: 1slb A: [24192]

Details for d1slba_

PDB Entry: 1slb, 2.3 Å

PDB Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides

PDB Compounds: (A:) bovine galectin-1

SCOPe Domain Sequences for d1slba_:

Sequence; same for both SEQRES and ATOM records:

>d1slba_ b.29.1.3 (A:) Galectin-1 {Cow (Bos taurus) [TaxId: 9913]}
acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
saggdfkikcvafe

Timeline for d1slba_:

• d1slba_ first appeared (with stable ids) in SCOP 1.55
  
• d1slba_ appears in SCOPe 2.04
  
• d1slba_ appears in SCOPe 2.06
  
• d1slba_ appears in the current release, SCOPe 2.08