SCOP 1.61: Domain d1slba_: 1slb A:

Lineage for d1slba_ (1slb A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins)

6. Protein S-lectin, different isoforms [49933] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)

8. Domain d1slba_: 1slb A: [24192]

Details for d1slba_

PDB Entry: 1slb, 2.3 Å

PDB Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides

SCOP Domain Sequences for d1slba_:

Sequence; same for both SEQRES and ATOM records:

>d1slba_ b.29.1.3 (A:) S-lectin, different isoforms {Cow (Bos taurus)}
acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
saggdfkikcvafe

Timeline for d1slba_:

• d1slba_ first appeared (with stable ids) in SCOP 1.55
  
• d1slba_ appears in SCOP 1.59
  
• d1slba_ appears in SCOP 1.63
  
• d1slba_ appears in the current release, SCOPe 2.08