SCOPe 2.06: Domain d2gcfa_: 2gcf A:

Lineage for d2gcfa_ (2gcf A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.0: automated matches [191590] (1 protein)
   not a true family

6. Protein automated matches [191063] (8 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1148] [255182] (3 PDB entries)

8. Domain d2gcfa_: 2gcf A: [241919]
   automated match to d1kqka_

Details for d2gcfa_

PDB Entry: 2gcf

PDB Description: Solution structure of the N-terminal domain of the coppper(I) ATPase PacS in its apo form

PDB Compounds: (A:) cation-transporting ATPase pacs

SCOPe Domain Sequences for d2gcfa_:

Sequence; same for both SEQRES and ATOM records:

>d2gcfa_ d.58.17.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
maqtinlqlegmrcaacassieraiakvpgvqscqvnfaleqavvsyhgettpqiltdav
eragyharvlkqq

Timeline for d2gcfa_:

• d2gcfa_ first appeared in SCOPe 2.04
  
• d2gcfa_ appears in SCOPe 2.05
  
• d2gcfa_ appears in SCOPe 2.07
  
• d2gcfa_ appears in the current release, SCOPe 2.08