![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.0: automated matches [191590] (1 protein) not a true family |
![]() | Protein automated matches [191063] (8 species) not a true protein |
![]() | Species Synechocystis sp. [TaxId:1148] [255182] (3 PDB entries) |
![]() | Domain d2gcfa_: 2gcf A: [241919] automated match to d1kqka_ |
PDB Entry: 2gcf (more details)
SCOPe Domain Sequences for d2gcfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gcfa_ d.58.17.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]} maqtinlqlegmrcaacassieraiakvpgvqscqvnfaleqavvsyhgettpqiltdav eragyharvlkqq
Timeline for d2gcfa_: