SCOPe 2.08: Domain d2gbgb2: 2gbg B:510-767

Lineage for d2gbgb2 (2gbg B:510-767)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (9 PDB entries)

8. Domain d2gbgb2: 2gbg B:510-767 [241918]
   Other proteins in same PDB: d2gbga1, d2gbgb1
   automated match to d4ffvb2
   complexed with 1ad, so4

Details for d2gbgb2

PDB Entry: 2gbg, 3 Å

PDB Description: rat dpp-iv with alkynyl cyanopyrrolidine #2

PDB Compounds: (B:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2gbgb2:

Sequence; same for both SEQRES and ATOM records:

>d2gbgb2 c.69.1.0 (B:510-767) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpskkldfivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatyla
steniivasfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstah
qhiyshmshflqqcfslr

Timeline for d2gbgb2:

• d2gbgb2 first appeared in SCOPe 2.04
  
• d2gbgb2 appears in SCOPe 2.07