Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (8 PDB entries) |
Domain d2gbfb2: 2gbf B:510-767 [241914] Other proteins in same PDB: d2gbfa1, d2gbfb1 automated match to d4ffvb2 complexed with aia |
PDB Entry: 2gbf (more details), 3.1 Å
SCOPe Domain Sequences for d2gbfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gbfb2 c.69.1.0 (B:510-767) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} mpskkldfivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatyla steniivasfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwg wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv msraenfkqveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstah qhiyshmshflqqcfslr
Timeline for d2gbfb2: