Lineage for d2gbfa2 (2gbf A:510-767)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153176Species Norway rat (Rattus norvegicus) [TaxId:10116] [188292] (8 PDB entries)
  8. 2153191Domain d2gbfa2: 2gbf A:510-767 [241912]
    Other proteins in same PDB: d2gbfa1, d2gbfb1
    automated match to d4ffvb2
    complexed with aia

Details for d2gbfa2

PDB Entry: 2gbf (more details), 3.1 Å

PDB Description: rat dpp-iv with alkynyl cyanopyrrolidine #1
PDB Compounds: (A:) dipeptidyl peptidase 4

SCOPe Domain Sequences for d2gbfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbfa2 c.69.1.0 (A:510-767) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mpskkldfivlnetrfwyqmilpphfdkskkypllidvyagpcsqkadaafrlnwatyla
steniivasfdgrgsgyqgdkimhainkrlgtlevedqieaarqflkmgfvdskrvaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdagvdfqamwytdedhgiasstah
qhiyshmshflqqcfslr

SCOPe Domain Coordinates for d2gbfa2:

Click to download the PDB-style file with coordinates for d2gbfa2.
(The format of our PDB-style files is described here.)

Timeline for d2gbfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gbfa1