Lineage for d1slcd_ (1slc D:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226891Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins)
  6. 226911Protein S-lectin, different isoforms [49933] (4 species)
  7. 226915Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)
  8. 226921Domain d1slcd_: 1slc D: [24191]
    complexed with gal, man, nag

Details for d1slcd_

PDB Entry: 1slc (more details), 2.15 Å

PDB Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides

SCOP Domain Sequences for d1slcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slcd_ b.29.1.3 (D:) S-lectin, different isoforms {Cow (Bos taurus)}
acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
saggdfkikcvafe

SCOP Domain Coordinates for d1slcd_:

Click to download the PDB-style file with coordinates for d1slcd_.
(The format of our PDB-style files is described here.)

Timeline for d1slcd_: