Lineage for d2g9oa_ (2g9o A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196856Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2196857Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2196963Protein automated matches [190409] (4 species)
    not a true protein
  7. 2196970Species Human (Homo sapiens) [TaxId:9606] [188690] (5 PDB entries)
  8. 2196974Domain d2g9oa_: 2g9o A: [241909]
    automated match to d1kqka_

Details for d2g9oa_

PDB Entry: 2g9o (more details)

PDB Description: solution structure of the apo form of the third metal-binding domain of atp7a protein (menkes disease protein)
PDB Compounds: (A:) Copper-transporting ATPase 1

SCOPe Domain Sequences for d2g9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g9oa_ d.58.17.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndstatfiidgmhckscvsniestlsalqyvssivvslenrsaivvynassvtpeslrka
ieavspglyrvsitsev

SCOPe Domain Coordinates for d2g9oa_:

Click to download the PDB-style file with coordinates for d2g9oa_.
(The format of our PDB-style files is described here.)

Timeline for d2g9oa_: