Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily) core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest |
Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families) topological similarity to the domain 2 of TM1585 automatically mapped to Pfam PF02615 |
Family c.122.1.0: automated matches [227150] (1 protein) not a true family |
Protein automated matches [226854] (3 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255180] (1 PDB entry) |
Domain d2g8yb_: 2g8y B: [241908] automated match to d1v9na_ complexed with 1pe, edo, nad, so4 |
PDB Entry: 2g8y (more details), 2.15 Å
SCOPe Domain Sequences for d2g8yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g8yb_ c.122.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} ghrfdaqtlhsfiqavfrqmgseeqeaklvadhliaanlaghdshgigmfpsyvrswsqg hlqinhhaktvkeagaavtldgdrafgqvaaheamalgiekahqhgiaavalhnshhigr igywaeqcaaagfvsihfvsvvgipmvapfhgrdsrfgtnpfcvvfprkdnfpllldyat saiafgktrvawhkgvpvppgclidvngvpttnpavmqesplgslltfaehkgyalaamc eilggalsggktthqetlqtspdailncmttiiinpelfgapdcnaqteafaewvkasph dddkpillpgewevntrrerqkqgipldagswqaicdaarqigmpeetlqafcqqlas
Timeline for d2g8yb_: