SCOPe 2.04: Domain d2g8yb_: 2g8y B:

Lineage for d2g8yb_ (2g8y B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
   core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest

4. Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families)
   topological similarity to the domain 2 of TM1585
   automatically mapped to Pfam PF02615

5. Family c.122.1.0: automated matches [227150] (1 protein)
   not a true family

6. Protein automated matches [226854] (3 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255180] (1 PDB entry)

8. Domain d2g8yb_: 2g8y B: [241908]
   automated match to d1v9na_
   complexed with 1pe, edo, nad, so4

Details for d2g8yb_

PDB Entry: 2g8y, 2.15 Å

PDB Description: the structure of a putative malate/lactate dehydrogenase from e. coli.

PDB Compounds: (B:) Malate/L-lactate dehydrogenases

SCOPe Domain Sequences for d2g8yb_:

Sequence; same for both SEQRES and ATOM records:

>d2g8yb_ c.122.1.0 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ghrfdaqtlhsfiqavfrqmgseeqeaklvadhliaanlaghdshgigmfpsyvrswsqg
hlqinhhaktvkeagaavtldgdrafgqvaaheamalgiekahqhgiaavalhnshhigr
igywaeqcaaagfvsihfvsvvgipmvapfhgrdsrfgtnpfcvvfprkdnfpllldyat
saiafgktrvawhkgvpvppgclidvngvpttnpavmqesplgslltfaehkgyalaamc
eilggalsggktthqetlqtspdailncmttiiinpelfgapdcnaqteafaewvkasph
dddkpillpgewevntrrerqkqgipldagswqaicdaarqigmpeetlqafcqqlas

Timeline for d2g8yb_:

• d2g8yb_ is new in SCOPe 2.04-stable
  
• d2g8yb_ appears in SCOPe 2.05
  
• d2g8yb_ appears in the current release, SCOPe 2.08