SCOPe 2.07: Domain d2g5mb1: 2g5m B:4-113

Lineage for d2g5mb1 (2g5m B:4-113)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (10 PDB entries)

8. Domain d2g5mb1: 2g5m B:4-113 [241903]
   Other proteins in same PDB: d2g5mb2
   automated match to d2he2b_

Details for d2g5mb1

PDB Entry: 2g5m

PDB Description: spinophilin pdz domain

PDB Compounds: (B:) Neurabin-2

SCOPe Domain Sequences for d2g5mb1:

Sequence; same for both SEQRES and ATOM records:

>d2g5mb1 b.36.1.0 (B:4-113) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
elfpvelekdseglgisiigmgagadmgleklgifvktvteggaahrdgriqvndllvev
dgtslvgvtqsfaasvlrntkgrvrfmigrerpgeqsevaqliqqtleqe

Timeline for d2g5mb1:

• d2g5mb1 first appeared in SCOPe 2.04, called d2g5mb_
  
• d2g5mb1 appears in SCOPe 2.06
  
• d2g5mb1 appears in the current release, SCOPe 2.08