SCOPe 2.06: Domain d2g1ma_: 2g1m A:

Lineage for d2g1ma_ (2g1m A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 proteins)
   Pfam PF13640; PubMed 16782814

6. Protein automated matches [254532] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255179] (25 PDB entries)

8. Domain d2g1ma_: 2g1m A: [241901]
   automated match to d2g19a_
   complexed with 4hg, fe2

Details for d2g1ma_

PDB Entry: 2g1m, 2.2 Å

PDB Description: cellular oxygen sensing: crystal structure of hypoxia-inducible factor prolyl hydroxylase (phd2)

PDB Compounds: (A:) Egl nine homolog 1

SCOPe Domain Sequences for d2g1ma_:

Sequence, based on SEQRES records:

>d2g1ma_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksds
skdirgdkitwiegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgng
tgyvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffw
sdrrnphevqpayatryaitvwyfdaderarakvky

Sequence, based on observed residues (ATOM records):

>d2g1ma_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsskdir
gdkitwiegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgngtgyvr
hvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffwsdrrn
phevqpayatryaitvwyfdaderarakvky

Timeline for d2g1ma_:

• d2g1ma_ first appeared in SCOPe 2.04
  
• d2g1ma_ appears in SCOPe 2.05
  
• d2g1ma_ appears in SCOPe 2.07
  
• d2g1ma_ appears in the current release, SCOPe 2.08