Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 proteins) Pfam PF13640; PubMed 16782814 |
Protein HIF-P4H2, PHD2 [254392] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254828] (1 PDB entry) |
Domain d2g19a_: 2g19 A: [241900] complexed with 4hg, fe2 |
PDB Entry: 2g19 (more details), 1.7 Å
SCOPe Domain Sequences for d2g19a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g19a_ b.82.2.15 (A:) HIF-P4H2, PHD2 {Human (Homo sapiens) [TaxId: 9606]} lpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksds skdirgdkitwiegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgng tgyvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffw sdrrnphevqpayatryaitvwyfdaderarakvky
Timeline for d2g19a_: