Lineage for d1slcb_ (1slc B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12682Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins)
  6. 12694Protein S-lectin, different isoforms [49933] (4 species)
  7. 12698Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)
  8. 12702Domain d1slcb_: 1slc B: [24189]

Details for d1slcb_

PDB Entry: 1slc (more details), 2.15 Å

PDB Description: x-ray crystallography reveals crosslinking of mammalian lectin (galectin-1) by biantennary complex type saccharides

SCOP Domain Sequences for d1slcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slcb_ b.29.1.3 (B:) S-lectin, different isoforms {Cow (Bos taurus)}
acglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivc
nskdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyl
saggdfkikcvafe

SCOP Domain Coordinates for d1slcb_:

Click to download the PDB-style file with coordinates for d1slcb_.
(The format of our PDB-style files is described here.)

Timeline for d1slcb_: