| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.61: LigT-like [55143] (1 superfamily) duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III |
Superfamily d.61.1: LigT-like [55144] (5 families) ![]() |
| Family d.61.1.0: automated matches [191492] (1 protein) not a true family |
| Protein automated matches [190796] (6 species) not a true protein |
| Species Pyrococcus furiosus [TaxId:186497] [255177] (1 PDB entry) |
| Domain d2fyha1: 2fyh A:1-184 [241886] Other proteins in same PDB: d2fyha2 automated match to d1vgja_ |
PDB Entry: 2fyh (more details)
SCOPe Domain Sequences for d2fyha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyha1 d.61.1.0 (A:1-184) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mrafiaidvsesvrdalvraqdyigskeakikfverenfhitlkflgeiteeqaeeikki
lekiakkykkhevnvrgigvfpnpnyvrviwagvendeiikkiakeiddelaklgfkkeg
nfvahitlgrvkfvkdklglamklkelanedfgsfiveaielkkstltpkgpiyetlarf
else
Timeline for d2fyha1: