Lineage for d2fyha1 (2fyh A:1-184)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199220Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2199221Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2199283Family d.61.1.0: automated matches [191492] (1 protein)
    not a true family
  6. 2199284Protein automated matches [190796] (6 species)
    not a true protein
  7. 2199316Species Pyrococcus furiosus [TaxId:186497] [255177] (1 PDB entry)
  8. 2199317Domain d2fyha1: 2fyh A:1-184 [241886]
    Other proteins in same PDB: d2fyha2
    automated match to d1vgja_

Details for d2fyha1

PDB Entry: 2fyh (more details)

PDB Description: Solution structure of the 2'-5' RNA ligase-like protein from Pyrococcus furiosus
PDB Compounds: (A:) putative integral membrane transport protein

SCOPe Domain Sequences for d2fyha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyha1 d.61.1.0 (A:1-184) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mrafiaidvsesvrdalvraqdyigskeakikfverenfhitlkflgeiteeqaeeikki
lekiakkykkhevnvrgigvfpnpnyvrviwagvendeiikkiakeiddelaklgfkkeg
nfvahitlgrvkfvkdklglamklkelanedfgsfiveaielkkstltpkgpiyetlarf
else

SCOPe Domain Coordinates for d2fyha1:

Click to download the PDB-style file with coordinates for d2fyha1.
(The format of our PDB-style files is described here.)

Timeline for d2fyha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fyha2