SCOPe 2.04: Domain d2fyha_: 2fyh A:

Lineage for d2fyha_ (2fyh A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.61: LigT-like [55143] (1 superfamily)
   duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III

4. Superfamily d.61.1: LigT-like [55144] (5 families)

5. Family d.61.1.0: automated matches [191492] (1 protein)
   not a true family

6. Protein automated matches [190796] (4 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [255177] (1 PDB entry)

8. Domain d2fyha_: 2fyh A: [241886]
   automated match to d1vgja_

Details for d2fyha_

PDB Entry: 2fyh

PDB Description: Solution structure of the 2'-5' RNA ligase-like protein from Pyrococcus furiosus

PDB Compounds: (A:) putative integral membrane transport protein

SCOPe Domain Sequences for d2fyha_:

Sequence; same for both SEQRES and ATOM records:

>d2fyha_ d.61.1.0 (A:) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mrafiaidvsesvrdalvraqdyigskeakikfverenfhitlkflgeiteeqaeeikki
lekiakkykkhevnvrgigvfpnpnyvrviwagvendeiikkiakeiddelaklgfkkeg
nfvahitlgrvkfvkdklglamklkelanedfgsfiveaielkkstltpkgpiyetlarf
elsehhhhhh

Timeline for d2fyha_:

• d2fyha_ is new in SCOPe 2.04-stable
  
• d2fyha_ appears in SCOPe 2.05
  
• d2fyha_ appears in the current release, SCOPe 2.08, called d2fyha1