Lineage for d2frya_ (2fry A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783781Protein automated matches [190043] (6 species)
    not a true protein
  7. 1783805Species Human (Homo sapiens) [TaxId:9606] [187799] (23 PDB entries)
  8. 1783834Domain d2frya_: 2fry A: [241881]
    automated match to d1u5sa1

Details for d2frya_

PDB Entry: 2fry (more details)

PDB Description: solution structure of the third sh3 domain of human nck2 adaptor protein
PDB Compounds: (A:) Cytoplasmic protein NCK2

SCOPe Domain Sequences for d2frya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2frya_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshvvqtlypfssvteeelnfekgetmeviekpendpewwkcknargqvglvpknyvvvl
s

SCOPe Domain Coordinates for d2frya_:

Click to download the PDB-style file with coordinates for d2frya_.
(The format of our PDB-style files is described here.)

Timeline for d2frya_: