| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
| Protein automated matches [191038] (29 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [255175] (2 PDB entries) |
| Domain d2fq2a_: 2fq2 A: [241879] automated match to d3gzmb_ complexed with pns |
PDB Entry: 2fq2 (more details)
SCOPe Domain Sequences for d2fq2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fq2a_ a.28.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
lkstfddikkiiskqlsveedkiqmnsnftkdlgadsldlvelimaleekfnvtisdqda
lkintvqdaidyieknnkq
Timeline for d2fq2a_: