SCOPe 2.07: Domain d2fq2a_: 2fq2 A:

Lineage for d2fq2a_ (2fq2 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (20 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [255175] (2 PDB entries)

8. Domain d2fq2a_: 2fq2 A: [241879]
   automated match to d3gzmb_
   complexed with pns

Details for d2fq2a_

PDB Entry: 2fq2

PDB Description: Solution structure of minor conformation of holo-acyl carrier protein from malaria parasite plasmodium falciparum

PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2fq2a_:

Sequence; same for both SEQRES and ATOM records:

>d2fq2a_ a.28.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
lkstfddikkiiskqlsveedkiqmnsnftkdlgadsldlvelimaleekfnvtisdqda
lkintvqdaidyieknnkq

Timeline for d2fq2a_:

• d2fq2a_ first appeared in SCOPe 2.04
  
• d2fq2a_ appears in SCOPe 2.06