Lineage for d2fonb3 (2fon B:462-658)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1731940Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1732074Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1732075Protein automated matches [226935] (21 species)
    not a true protein
  7. 1732211Species Solanum lycopersicum [TaxId:4081] [255174] (1 PDB entry)
  8. 1732215Domain d2fonb3: 2fon B:462-658 [241874]
    Other proteins in same PDB: d2fona1, d2fonb1, d2fonc1
    automated match to d1w07a2
    complexed with fad

Details for d2fonb3

PDB Entry: 2fon (more details), 2.74 Å

PDB Description: x-ray crystal structure of leacx1, an acyl-coa oxidase from lycopersicon esculentum (tomato)
PDB Compounds: (B:) peroxisomal acyl-CoA oxidase 1A

SCOPe Domain Sequences for d2fonb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fonb3 a.29.3.0 (B:462-658) automated matches {Solanum lycopersicum [TaxId: 4081]}
ehlmqcrsdvkqaedwlkpsavleafearsarmsvacaknlskfenqeegfaelaadlve
aavahcqlivvskyieklqqnipgkgvkqqlevlcgiyslfilhkhqgdflgtgyitskq
gslandqlralysqlrpnavslvdafnytdhylgsilgrydgnvypklyeaawkdplnks
diadgfheyirpllkqq

SCOPe Domain Coordinates for d2fonb3:

Click to download the PDB-style file with coordinates for d2fonb3.
(The format of our PDB-style files is described here.)

Timeline for d2fonb3: