![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
![]() | Protein automated matches [226935] (30 species) not a true protein |
![]() | Species Solanum lycopersicum [TaxId:4081] [255174] (1 PDB entry) |
![]() | Domain d2fonb2: 2fon B:273-461 [241873] Other proteins in same PDB: d2fona1, d2fonb1, d2fonc1 automated match to d1w07a1 complexed with fad |
PDB Entry: 2fon (more details), 2.74 Å
SCOPe Domain Sequences for d2fonb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fonb2 a.29.3.0 (B:273-461) automated matches {Solanum lycopersicum [TaxId: 4081]} prqllygtmvyvrqsivadaslamsravciatrysavrrqfgsqnggqetqvidyktqqn rlfpllasayafrfvgewlkwlytdvtqrlaandfstlpeahactaglkslttsatadgi eecrklcgghgylcssglpelfavyvpactyegdnvvlqlqvarflmktisqlgtgkkpv gtvsymgri
Timeline for d2fonb2: