Lineage for d2fonb1 (2fon B:3-272)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015483Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 3015484Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 3015629Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 3015630Protein automated matches [226934] (29 species)
    not a true protein
  7. 3015807Species Solanum lycopersicum [TaxId:4081] [255173] (1 PDB entry)
  8. 3015809Domain d2fonb1: 2fon B:3-272 [241872]
    Other proteins in same PDB: d2fona2, d2fona3, d2fonb2, d2fonb3, d2fonc2, d2fonc3
    automated match to d1w07a3
    complexed with fad

Details for d2fonb1

PDB Entry: 2fon (more details), 2.74 Å

PDB Description: x-ray crystal structure of leacx1, an acyl-coa oxidase from lycopersicon esculentum (tomato)
PDB Compounds: (B:) peroxisomal acyl-CoA oxidase 1A

SCOPe Domain Sequences for d2fonb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fonb1 e.6.1.0 (B:3-272) automated matches {Solanum lycopersicum [TaxId: 4081]}
gvdyladerkkagfdvdemkivwagsrhdfeltdrisklvasdpgfskegrtmlprkelf
kntlrkaayawkriielrlsqeeatmlrryvdepaftdlhwgmfipaikgqgtdkqqekw
lplaykmqiigcyaqtelghgsnvqglettatfdpqtdefvihsptltsskwwpgglgkv
sthavvyarlitdgkdygvngfivqlrsledhkplpgvtvgdigmkfgngaynsmdngvl
sfdhvriprdqmlmrvsqvtkegkyvqsdi

SCOPe Domain Coordinates for d2fonb1:

Click to download the PDB-style file with coordinates for d2fonb1.
(The format of our PDB-style files is described here.)

Timeline for d2fonb1: