SCOP 1.63: Domain d1sltb_: 1slt B:

Lineage for d1sltb_ (1slt B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins)

6. Protein S-lectin, different isoforms [49933] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)

8. Domain d1sltb_: 1slt B: [24187]
   complexed with cl, cyo, gal, nag

Details for d1sltb_

PDB Entry: 1slt, 1.9 Å

PDB Description: structure of s-lectin, a developmentally regulated vertebrate beta- galactoside binding protein

SCOP Domain Sequences for d1sltb_:

Sequence; same for both SEQRES and ATOM records:

>d1sltb_ b.29.1.3 (B:) S-lectin, different isoforms {Cow (Bos taurus)}
glvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivcns
kdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainylsa
ggdfkikcvafe

Timeline for d1sltb_:

• d1sltb_ first appeared (with stable ids) in SCOP 1.55
  
• d1sltb_ appears in SCOP 1.61
  
• d1sltb_ appears in SCOP 1.65
  
• d1sltb_ appears in the current release, SCOPe 2.08