Lineage for d1sltb_ (1slt B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108496Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 108497Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) (S)
  5. 108825Family b.29.1.3: Galectin (animal S-lectin) [49932] (4 proteins)
  6. 108838Protein S-lectin, different isoforms [49933] (4 species)
  7. 108842Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)
  8. 108844Domain d1sltb_: 1slt B: [24187]

Details for d1sltb_

PDB Entry: 1slt (more details), 1.9 Å

PDB Description: structure of s-lectin, a developmentally regulated vertebrate beta- galactoside binding protein

SCOP Domain Sequences for d1sltb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sltb_ b.29.1.3 (B:) S-lectin, different isoforms {Cow (Bos taurus)}
glvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivcns
kdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainylsa
ggdfkikcvafe

SCOP Domain Coordinates for d1sltb_:

Click to download the PDB-style file with coordinates for d1sltb_.
(The format of our PDB-style files is described here.)

Timeline for d1sltb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1slta_