Lineage for d2fona1 (2fon A:3-272)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1950935Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1950936Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1951081Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1951082Protein automated matches [226934] (20 species)
    not a true protein
  7. 1951201Species Solanum lycopersicum [TaxId:4081] [255173] (1 PDB entry)
  8. 1951202Domain d2fona1: 2fon A:3-272 [241869]
    Other proteins in same PDB: d2fona2, d2fona3, d2fonb2, d2fonb3, d2fonc2, d2fonc3
    automated match to d1w07a3
    complexed with fad

Details for d2fona1

PDB Entry: 2fon (more details), 2.74 Å

PDB Description: x-ray crystal structure of leacx1, an acyl-coa oxidase from lycopersicon esculentum (tomato)
PDB Compounds: (A:) peroxisomal acyl-CoA oxidase 1A

SCOPe Domain Sequences for d2fona1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fona1 e.6.1.0 (A:3-272) automated matches {Solanum lycopersicum [TaxId: 4081]}
gvdyladerkkagfdvdemkivwagsrhdfeltdrisklvasdpgfskegrtmlprkelf
kntlrkaayawkriielrlsqeeatmlrryvdepaftdlhwgmfipaikgqgtdkqqekw
lplaykmqiigcyaqtelghgsnvqglettatfdpqtdefvihsptltsskwwpgglgkv
sthavvyarlitdgkdygvngfivqlrsledhkplpgvtvgdigmkfgngaynsmdngvl
sfdhvriprdqmlmrvsqvtkegkyvqsdi

SCOPe Domain Coordinates for d2fona1:

Click to download the PDB-style file with coordinates for d2fona1.
(The format of our PDB-style files is described here.)

Timeline for d2fona1: