Lineage for d1slta_ (1slt A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 294847Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins)
  6. 294867Protein S-lectin, different isoforms [49933] (4 species)
  7. 294871Species Cow (Bos taurus) [TaxId:9913] [49934] (4 PDB entries)
  8. 294872Domain d1slta_: 1slt A: [24186]

Details for d1slta_

PDB Entry: 1slt (more details), 1.9 Å

PDB Description: structure of s-lectin, a developmentally regulated vertebrate beta- galactoside binding protein

SCOP Domain Sequences for d1slta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1slta_ b.29.1.3 (A:) S-lectin, different isoforms {Cow (Bos taurus)}
cglvasnlnlkpgeclrvrgevaadaksfllnlgkddnnlclhfnprfnahgdvntivcn
skdagawgaeqresafpfqpgsvvevcisfnqtdltiklpdgyefkfpnrlnleainyls
aggdfkikcvafe

SCOP Domain Coordinates for d1slta_:

Click to download the PDB-style file with coordinates for d1slta_.
(The format of our PDB-style files is described here.)

Timeline for d1slta_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1sltb_