SCOPe 2.08: Domain d2finb_: 2fin B:

Lineage for d2finb_ (2fin B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein Macrophage inflammatory protein, MIP [54128] (5 species)
   has different dimerisation mode

7. Species Human (Homo sapiens), 1-beta [TaxId:9606] [54129] (7 PDB entries)

8. Domain d2finb_: 2fin B: [241857]
   Other proteins in same PDB: d2fina_
   automated match to d1huna_

Details for d2finb_

PDB Entry: 2fin

PDB Description: solution structure of the complex between poxvirus-encoded cc chemokine inhibitor vcci and human mip-1beta, ensemble structure

PDB Compounds: (B:) Small inducible cytokine A4

SCOPe Domain Sequences for d2finb_:

Sequence; same for both SEQRES and ATOM records:

>d2finb_ d.9.1.1 (B:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-beta [TaxId: 9606]}
apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtaasaqvcadpseswvq
eyvydleln

Timeline for d2finb_:

• d2finb_ first appeared in SCOPe 2.04
  
• d2finb_ appears in SCOPe 2.07