Lineage for d2finb_ (2fin B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929052Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 2929076Species Human (Homo sapiens), 1-beta [TaxId:9606] [54129] (7 PDB entries)
  8. 2929087Domain d2finb_: 2fin B: [241857]
    Other proteins in same PDB: d2fina_
    automated match to d1huna_

Details for d2finb_

PDB Entry: 2fin (more details)

PDB Description: solution structure of the complex between poxvirus-encoded cc chemokine inhibitor vcci and human mip-1beta, ensemble structure
PDB Compounds: (B:) Small inducible cytokine A4

SCOPe Domain Sequences for d2finb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2finb_ d.9.1.1 (B:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-beta [TaxId: 9606]}
apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtaasaqvcadpseswvq
eyvydleln

SCOPe Domain Coordinates for d2finb_:

Click to download the PDB-style file with coordinates for d2finb_.
(The format of our PDB-style files is described here.)

Timeline for d2finb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fina_